Product Description
Size: 20ul / 100ul
The SCD1 (81468-5-RR) by Proteintech is a Recombinant antibody targeting SCD1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples
81468-5-RR targets SCD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, HEK-293 cells
Positive IF/ICC detected in: MCF-7 cells
Positive FC (Intra) detected in: HepG2 cells, MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species
Full Name: stearoyl-CoA desaturase (delta-9-desaturase)
Calculated Molecular Weight: 355 aa, 41 kDa
Observed Molecular Weight: 28-42 kDa
GenBank Accession Number: BC005807
Gene Symbol: SCD
Gene ID (NCBI): 6319
RRID: AB_3670496
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: O00767
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924