{"product_id":"proteintech-81471-1-rr","title":"Proteintech, 81471-1-RR, FTO Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FTO (81471-1-RR) by Proteintech is a Recombinant antibody targeting FTO in WB, IF\/ICC, ELISA applications with reactivity to human samples\n81471-1-RR targets FTO in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-231 cells,  HEK-293T cells,  LNCaP cells,  Jurkat cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in th1e FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species\nFull Name: fat mass and obesity associated\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: NM_001080432\nGene Symbol: FTO\nGene ID (NCBI): 79068\nRRID: AB_2935551\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9C0B1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888344813737,"sku":"81471-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-81471-1-rr","provider":"Iright","version":"1.0","type":"link"}