{"product_id":"proteintech-81778-1-rr","title":"Proteintech, 81778-1-RR, PROX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PROX1 (81778-1-RR) by Proteintech is a Recombinant antibody targeting PROX1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n81778-1-RR targets PROX1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HuH-7 cells,  SH-SY5Y cells\nPositive IF\/ICC detected in: HuH-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:650-1:2600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPROX1, Prospero homeobox protein 1, belongs to the Prospero homeobox family and contain a Prospero-type homeobox DNA-binding domain. PROX1 plays a fundamental role in early development of CNS and regulates the expression of gene and development of postmitotic, undifferentiated neurons. Also, PROX1 is a required regulator of the development of the lymphatic system. This antibody is raised against part of C-terminal chain of human PROX1. The calculated molecular weight of PROX1 is 83 kDa, but with post-translational modifications, PROX1 is about 90 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1543 Product name: Recombinant human PROX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-736 aa of BC024201 Sequence: TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH Predict reactive species\nFull Name: prospero homeobox 1\nCalculated Molecular Weight: 737 aa, 83 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC024201\nGene Symbol: PROX1\nGene ID (NCBI): 5629\nRRID: AB_2935579\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92786\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888659386537,"sku":"81778-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-81778-1-rr","provider":"Iright","version":"1.0","type":"link"}