{"product_id":"proteintech-81987-4-rr","title":"Proteintech, 81987-4-RR, WTAP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe WTAP (81987-4-RR) by Proteintech is a Recombinant antibody targeting WTAP in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n81987-4-RR targets WTAP in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HEK-293 cells,  Jurkat cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWTAP, also named as KIAA0105 and hFL(2)D, is  previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 45-50 kDa due to phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0259 Product name: Recombinant human WTAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-150 aa of BC000383 Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD Predict reactive species\nFull Name: Wilms tumor 1 associated protein\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC000383\nGene Symbol: WTAP\nGene ID (NCBI): 9589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15007\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888677638313,"sku":"81987-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-81987-4-rr","provider":"Iright","version":"1.0","type":"link"}