Proteintech, 82115-3-RR, SLC7A11/xCT Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC7A11/xCT (82115-3-RR) by Proteintech is a Recombinant antibody targeting SLC7A11/xCT in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 82115-3-RR targets SLC7A11/xCT in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: unboiled HeLa cells, unboiled mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer. The SLC7A11 protein appears at two molecular weights, 55 kDa and 35 kDa, and the 55 kDa protein is ubiquitinated(PMID: 32188872). 82115-3-RR recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25431 Product name: Recombinant human SLC7A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC012087 Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR Predict reactive species Full Name: solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC012087 Gene Symbol: SLC7A11 Gene ID (NCBI): 23657 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UPY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.