{"product_id":"proteintech-82121-1-rr","title":"Proteintech, 82121-1-RR, TCTN2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TCTN2 (82121-1-RR) by Proteintech is a Recombinant antibody targeting TCTN2 in WB, ELISA applications with reactivity to Human, rat samples\n82121-1-RR targets TCTN2 in WB, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A431 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCTN2 (tectonic-2 or TECT2) is a type I membrane protein that belongs to the tectonic family, which consists of TCTN1, TCTN2 and TCTN3. Studies in mice suggest that tectonic may be involved in Hedgehog (Hh) signaling, and essential for ciliogenesis. Tectonic is component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.  It exists two spilcing isoforms. The first aberrant transcript introduces 104 base pair from intron 13 and would delete 196 original amino acid, introduce two novel amino acids, and prematurely truncate the 697aa protein at residue number 504. The second transcript lacks exon 14 and would delete 195 original amino acids, introduce four novel amino acids, and prematurely truncate the 697 aa protein at residue number 507. The molecular weight of two isoforms are about 50kDa. We detected the 50kDa and 90kDa protein by immunoprecipitaion, but 50kDa protein may be the splicing isoform or non-specific band.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10725 Product name: Recombinant human TCTN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 351-697 aa of BC009112 Sequence: VIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVAKGLLLLLFLTLALFLSNPWTRICKAYS Predict reactive species\nFull Name: tectonic family member 2\nCalculated Molecular Weight: 697 aa, 77 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC009112\nGene Symbol: TCTN2\nGene ID (NCBI): 79867\nRRID: AB_3086465\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96GX1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888669315241,"sku":"82121-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82121-1-rr","provider":"Iright","version":"1.0","type":"link"}