Proteintech, 82531-3-RR, S100A8 Recombinant monoclonal antibody

Size: 20ul / 100ul The S100A8 (82531-3-RR) by Proteintech is a Recombinant antibody targeting S100A8 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 82531-3-RR targets S100A8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, MCF-7 cells, SK-BR-3 cells Positive IP detected in: MCF-7 cells, HL-60 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3752 Product name: Recombinant Human S100A8 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species Full Name: S100 calcium binding protein A8 Calculated Molecular Weight: 93 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC005928 Gene Symbol: S100A8 Gene ID (NCBI): 6279 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.