{"product_id":"proteintech-82540-1-rr","title":"Proteintech, 82540-1-RR, TIM23 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TIM23 (82540-1-RR) by Proteintech is a Recombinant antibody targeting TIM23 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n82540-1-RR targets TIM23 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  mouse heart tissue,  rat heart tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTim23, a key component of the mitochondrial preprotein translocase, is anchored in the inner membrane by its C-terminal domain and exposes an intermediate domain in the intermembrane space that functions as a presequence receptor. Tim23 is the main component of the translocation channel of the TIM23 complex. (PMID: 10830167, PMID: 25083920)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1620 Product name: Recombinant human Tim23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC062707 Sequence: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFIPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL Predict reactive species\nFull Name: translocase of inner mitochondrial membrane 23\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC062707\nGene Symbol: TIMM23\nGene ID (NCBI): 100287932\nRRID: AB_3086488\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O14925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888361853097,"sku":"82540-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82540-1-rr","provider":"Iright","version":"1.0","type":"link"}