{"product_id":"proteintech-82585-1-rr","title":"Proteintech, 82585-1-RR, NAT10 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NAT10 (82585-1-RR) by Proteintech is a Recombinant antibody targeting NAT10 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n82585-1-RR targets NAT10 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HEK-293 cells,  Jurkat cells,  K-562 cells\nPositive IP detected in: mouse testis tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1500-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. The specificity of this antibody has been tested by siRNA (PMID: 24786082). NAT10 regulates mitotic cell fate by acetylating Eg5. NAT10 depletion results in multinuclear giant cells, which is the hallmark of mitotic catastrophe (PMID: 35210604). NAT10 plays a crucial role in carcinogenesis through influencing EMT, hypoxia, ribosomal biogenesis and overall, promoting translational efficiency. Recently, we reported that treating cancer cells with Remodelin, a small molecule inhibitor of NAT10, causes alteration in global lipid metabolism (PMID: 36149760).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4184 Product name: Recombinant human NAT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 676-1025 aa of BC035558 Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK Predict reactive species\nFull Name: N-acetyltransferase 10 (GCN5-related)\nCalculated Molecular Weight: 1025 aa, 116 kDa\nObserved Molecular Weight: 116 kDa\nGenBank Accession Number: BC035558\nGene Symbol: NAT10\nGene ID (NCBI): 55226\nRRID: AB_3086490\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H0A0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888357888169,"sku":"82585-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82585-1-rr","provider":"Iright","version":"1.0","type":"link"}