{"product_id":"proteintech-82659-1-rr","title":"Proteintech, 82659-1-RR, CDX2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDX2 (82659-1-RR) by Proteintech is a Recombinant antibody targeting CDX2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n82659-1-RR targets CDX2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, mouse colon tissue,  COLO 320 cells\nPositive IHC detected in: rat colon tissue, human colon cancer tissue,  human rectal cancer tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17310 Product name: Recombinant human CDX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC014461 Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ Predict reactive species\nFull Name: caudal type homeobox 2\nCalculated Molecular Weight: 313 aa, 34 kDa\nObserved Molecular Weight: 33-40 kDa\nGenBank Accession Number: BC014461\nGene Symbol: CDX2\nGene ID (NCBI): 1045\nRRID: AB_3086497\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99626\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888368898217,"sku":"82659-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82659-1-rr","provider":"Iright","version":"1.0","type":"link"}