Proteintech, 82689-3-RR, INPP5E Recombinant monoclonal antibody

Size: 20ul / 100ul The INPP5E (82689-3-RR) by Proteintech is a Recombinant antibody targeting INPP5E in IF/ICC, ELISA applications with reactivity to human samples 82689-3-RR targets INPP5E in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: Starvation treated hTERT-RPE1 cells, hTERT-RPE1 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information INPP5E(72 kDa inositol polyphosphate 5-phosphatase) converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns-P2.In mouse, highest protein expression was in brain, heart, and testis, with lower expression in thymus and lung, and very little expression in kidney, spleen, and liver(PMID:10764818). Defects in INPP5E are the cause of Joubert syndrome type 1 (JBTS1) and mental retardation-truncal obesity-retinal dystrophy-micropenis (MORMS)(PMID:19668215). It has 2 isoforms with the molecular mass of 66 kDa and 70 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30305 Product name: Recombinant human INPP5E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-350 aa of BC028032 Sequence: RLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET Predict reactive species Full Name: inositol polyphosphate-5-phosphatase, 72 kDa Calculated Molecular Weight: 644 aa, 70 kDa Observed Molecular Weight: 64-66 kDa GenBank Accession Number: BC028032 Gene Symbol: INPP5E Gene ID (NCBI): 56623 RRID: AB_3670528 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.