{"product_id":"proteintech-82695-4-rr","title":"Proteintech, 82695-4-RR, MCL1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MCL1 (82695-4-RR) by Proteintech is a Recombinant antibody targeting MCL1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n82695-4-RR targets MCL1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MDA-MB-231 cells,  Jurkat cells,  Raji cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovarian  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and\/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumor malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target.  MCL-1 can be alternatively spliced into a long form (MCL-1L, 40 kDa) or a short form (MCL-1S, 30 kDa). (PMID: 15467463, PMID: 15147382)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10397 Product name: Recombinant human MCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-327 aa of BC107735 Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG Predict reactive species\nFull Name: myeloid cell leukemia sequence 1 (BCL2-related)\nCalculated Molecular Weight: 350 aa, 37 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC107735\nGene Symbol: MCL1\nGene ID (NCBI): 4170\nRRID: AB_3086509\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q07820\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888357167273,"sku":"82695-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82695-4-rr","provider":"Iright","version":"1.0","type":"link"}