{"product_id":"proteintech-82715-1-rr","title":"Proteintech, 82715-1-RR, NCAM1\/CD56 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NCAM1\/CD56 (82715-1-RR) by Proteintech is a Recombinant antibody targeting NCAM1\/CD56 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n82715-1-RR targets NCAM1\/CD56 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, SH-SY5Y cells,  U-251 cells,  Neuro-2a cells,  C6 cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, human tonsillitis tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK\/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isofroms have also been described (PMID: 1856291).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5528 Product name: Recombinant human NCAM1\/CD56 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-352 aa of BC047244 Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE Predict reactive species\nFull Name: neural cell adhesion molecule 1\nCalculated Molecular Weight: 95 kDa\nObserved Molecular Weight: 120 kDa, 140 kDa, 180 kDa\nGenBank Accession Number: BC047244\nGene Symbol: NCAM1\nGene ID (NCBI): 4684\nENSEMBL Gene ID: ENSG00000149294\nRRID: AB_3086516\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P13591\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888349728937,"sku":"82715-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82715-1-rr","provider":"Iright","version":"1.0","type":"link"}