{"product_id":"proteintech-82765-1-rr","title":"Proteintech, 82765-1-RR, Thioredoxin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Thioredoxin (82765-1-RR) by Proteintech is a Recombinant antibody targeting Thioredoxin in WB, IHC, ELISA applications with reactivity to human samples\n82765-1-RR targets Thioredoxin in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  K-562 cells,  MCF-7 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS\/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation\/reduction status and stimulates AP-1 transcriptional activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6989 Product name: Recombinant human TXN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC003377 Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Predict reactive species\nFull Name: thioredoxin\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC003377\nGene Symbol: TXN\nGene ID (NCBI): 7295\nRRID: AB_3086531\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10599\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888535818409,"sku":"82765-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82765-1-rr","provider":"Iright","version":"1.0","type":"link"}