{"product_id":"proteintech-82787-3-rr","title":"Proteintech, 82787-3-RR, Cannabinoid receptor 1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Cannabinoid receptor 1 (82787-3-RR) by Proteintech is a Recombinant antibody targeting Cannabinoid receptor 1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n82787-3-RR targets Cannabinoid receptor 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag12625 Product name: Recombinant human CNR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-121 aa of BC074812 Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV Predict reactive species\nFull Name: cannabinoid receptor 1 (brain)\nCalculated Molecular Weight: 472 aa, 53 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC074812\nGene Symbol: Cannabinoid receptor 1\nGene ID (NCBI): 1268\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P21554\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888595456169,"sku":"82787-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82787-3-rr","provider":"Iright","version":"1.0","type":"link"}