{"product_id":"proteintech-82788-1-rr","title":"Proteintech, 82788-1-RR, RACGAP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RACGAP1 (82788-1-RR) by Proteintech is a Recombinant antibody targeting RACGAP1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n82788-1-RR targets RACGAP1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  U2OS cells,  K-562 cells,  Jurkat cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRac GTPase-activating protein 1 (RACGAP1), localized in the mitotic spindle, has guanosine triphosphatase-activating protein (GAP) activity for the Rho family GTPases. RACGAP1 has an important influence on the initiation of cytokinesis, control of cell growth and differentiation, regulation of spermatogenesis, and tumor metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4676 Product name: Recombinant human RACGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-632 aa of BC032754 Sequence: PCIPTLIGTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK Predict reactive species\nFull Name: Rac GTPase activating protein 1\nCalculated Molecular Weight: 632 aa, 71 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC032754\nGene Symbol: RACGAP1\nGene ID (NCBI): 29127\nRRID: AB_3670551\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H0H5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888440758441,"sku":"82788-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82788-1-rr","provider":"Iright","version":"1.0","type":"link"}