{"product_id":"proteintech-82822-2-rr","title":"Proteintech, 82822-2-RR, GPX4 (Human Specific) Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GPX4 (Human Specific) (82822-2-RR) by Proteintech is a Recombinant antibody targeting GPX4 (Human Specific) in WB, ELISA applications with reactivity to human samples\n82822-2-RR targets GPX4 (Human Specific) in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:15000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701).82822-2-RR is human specific.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species\nFull Name: glutathione peroxidase 4 (phospholipid hydroperoxidase)\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC021567\nGene Symbol: GPX4\nGene ID (NCBI): 2879\nRRID: AB_3086547\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P36969\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888530378921,"sku":"82822-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82822-2-rr","provider":"Iright","version":"1.0","type":"link"}