Proteintech, 82841-1-RR, Lipocalin-2/NGAL Recombinant monoclonal antibody

Size: 20ul / 100ul The Lipocalin-2/NGAL (82841-1-RR) by Proteintech is a Recombinant antibody targeting Lipocalin-2/NGAL in WB, IHC, ELISA applications with reactivity to human samples 82841-1-RR targets Lipocalin-2/NGAL in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva, HT-29 cells, SW480 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0268 Product name: Recombinant Human NGAL/Lipocalin-2 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*HIS Domain: 21-198 aa of NP_005555.2 Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG Predict reactive species Full Name: lipocalin 2 Calculated Molecular Weight: 23kd Observed Molecular Weight: 22 kDa GenBank Accession Number: NP_005555.2 Gene Symbol: NGAL/LCN2 Gene ID (NCBI): 3934 RRID: AB_3086550 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P80188 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.