{"product_id":"proteintech-82852-3-rr","title":"Proteintech, 82852-3-RR, MAZ Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MAZ (82852-3-RR) by Proteintech is a Recombinant antibody targeting MAZ in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n82852-3-RR targets MAZ in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyc-associated zinc-finger protein (MAZ) is a transcription factor with dual roles in transcription initiation and termination. MAZ can activate the expression of a variety of genes such as the c-Myc, insulin, VEGF, and RAS gene family and the serotonin 1A receptor. MAZ plays a critical role in the progression of various cancers including breast, prostate, liver, and so on. Deregulation of MAZ expression is associated with the progression of pancreatic ductal adenocarcinoma (PDAC)(PMID: 29414775).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15200 Product name: Recombinant human MAZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC041629 Sequence: MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG Predict reactive species\nFull Name: MYC-associated zinc finger protein (purine-binding transcription factor)\nCalculated Molecular Weight: 477 aa, 49 kDa\nObserved Molecular Weight: 49-51 kDa\nGenBank Accession Number: BC041629\nGene Symbol: MAZ\nGene ID (NCBI): 4150\nRRID: AB_3086554\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P56270\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888851275945,"sku":"82852-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82852-3-rr","provider":"Iright","version":"1.0","type":"link"}