{"product_id":"proteintech-82879-1-rr","title":"Proteintech, 82879-1-RR, NOP58 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NOP58 (82879-1-RR) by Proteintech is a Recombinant antibody targeting NOP58 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n82879-1-RR targets NOP58 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  Jurkat cells,  K-562 cells,  HEK-293 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe box C\/D snoRNPs are named for the short, conserved box C (UGAUGA) and box D (CUGA) sequences present in their RNA moiety. The box C\/D sequences are also required for multiple aspects. of snoRNA biogenesis, including RNA stability, intronic processing, nucleolar targeting, nuclear retention, and 59 trimethylguanosine cap formation (PMID:9649444,8878486). Nop58 is a component common to the box C\/D small nucleolar ribonucleoprotein (PMID:10606270).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5740 Product name: Recombinant human NOP58 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-529 aa of BC032592 Sequence: MMAIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED Predict reactive species\nFull Name: NOP58 ribonucleoprotein homolog (yeast)\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC032592\nGene Symbol: NOP58\nGene ID (NCBI): 51602\nRRID: AB_3670598\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y2X3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888345436329,"sku":"82879-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82879-1-rr","provider":"Iright","version":"1.0","type":"link"}