Proteintech, 82887-1-RR, E2F7 Recombinant monoclonal antibody

Size: 20ul / 100ul The E2F7 (82887-1-RR) by Proteintech is a Recombinant antibody targeting E2F7 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82887-1-RR targets E2F7 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information E2F7 also named as E2F transcription factor 7 is a 911 amino acid protein, which belongs to the E2F/DP family. E2F7 localizes in the nucleus and mainly forms homodimers and, to a lesser extent, heterodimers with E2F8. E2F7 as a transcription factor involves in various processes such as angiogenesis, polyploidization of specialized cells and DNA damage response. E2F7 mainly forms homodimers and to a lesser extent, heterodimers with E2F8. (PMID: 18194653 ) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21599 Product name: Recombinant human E2F7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 369-713 aa of BC136366 Sequence: VDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPA Predict reactive species Full Name: E2F transcription factor 7 Calculated Molecular Weight: 911 aa, 100 kDa GenBank Accession Number: BC136366 Gene Symbol: E2F7 Gene ID (NCBI): 144455 RRID: AB_3670606 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96AV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.