Proteintech, 82898-1-RR, KPNA4 Recombinant monoclonal antibody

Size: 20ul / 100ul The KPNA4 (82898-1-RR) by Proteintech is a Recombinant antibody targeting KPNA4 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82898-1-RR targets KPNA4 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, Jurkat cells Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3133 Product name: Recombinant human KPNA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC034493 Sequence: MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL Predict reactive species Full Name: karyopherin alpha 4 (importin alpha 3) Calculated Molecular Weight: 521 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC034493 Gene Symbol: KPNA4 Gene ID (NCBI): 3840 RRID: AB_3670626 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.