Proteintech, 82916-2-RR, COXIV Recombinant monoclonal antibody

Size: 20ul / 100ul The COXIV (82916-2-RR) by Proteintech is a Recombinant antibody targeting COXIV in IF/ICC, ELISA applications with reactivity to human samples 82916-2-RR targets COXIV in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1640 Product name: Recombinant human COXIV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC021236 Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Predict reactive species Full Name: cytochrome c oxidase subunit IV isoform 1 Calculated Molecular Weight: 19.6 kDa GenBank Accession Number: BC021236 Gene Symbol: COX IV Gene ID (NCBI): 1327 RRID: AB_3670650 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13073 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.