{"product_id":"proteintech-82931-1-rr","title":"Proteintech, 82931-1-RR, KHSRP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KHSRP (82931-1-RR) by Proteintech is a Recombinant antibody targeting KHSRP in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n82931-1-RR targets KHSRP in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  Jurkat cells,  mouse spleen tissue,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKHSRP, also named as FUBP2, KSRP,  and p75, belongs to the KHSRP family.  It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possi3bly by recruiting degradation machinery to ARE-containing mRNAs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33890 Product name: Recombinant human KHSRP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-710 aa of NM_003685 Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ Predict reactive species\nFull Name: KH-type splicing regulatory protein\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: NM_003685\nGene Symbol: KHSRP\nGene ID (NCBI): 8570\nRRID: AB_3670669\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92945\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888345305257,"sku":"82931-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82931-1-rr","provider":"Iright","version":"1.0","type":"link"}