{"product_id":"proteintech-82935-1-rr","title":"Proteintech, 82935-1-RR, PAK7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PAK7 (82935-1-RR) by Proteintech is a Recombinant antibody targeting PAK7 in WB, FC (Intra), ELISA applications with reactivity to human samples\n82935-1-RR targets PAK7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells\nPositive FC (Intra) detected in: K-562 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAK7, also known as PAK5, is a newly found but scarcely researched type II PAKs (PAK4, 5, 6). PAK7 was originally found in the brain, which promotes filopodia formation in nerve cells. Recently,  studies have found that the expression level of PAK7 significantly increased in colorectal cancer, ovarian cancer, gastric cancer, neuroglioma, hepatocellular carcinoma, pancreatic cancer, osteosarcoma, and breast cancer. PAK7 plays an important role in tumorigenesis, invasion, and metastasis,  mainly related to its mechanism of regulating cytoskeleton, inhibiting apoptosis, and promoting proliferation. The calculated molecular weight of PAK7 is 80 kDa (PMID: 29805709, PMID: 34165002).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29190 Product name: Recombinant human PAK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-360 aa of BC024179 Sequence: AYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS Predict reactive species\nFull Name: p21 protein (Cdc42\/Rac)-activated kinase 7\nCalculated Molecular Weight: 719 aa, 81 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC024179\nGene Symbol: PAK7\nGene ID (NCBI): 57144\nRRID: AB_3670677\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P286\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888358641833,"sku":"82935-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82935-1-rr","provider":"Iright","version":"1.0","type":"link"}