{"product_id":"proteintech-82940-1-rr","title":"Proteintech, 82940-1-RR, CAMP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CAMP (82940-1-RR) by Proteintech is a Recombinant antibody targeting CAMP in WB, ELISA applications with reactivity to human, mouse samples\n82940-1-RR targets CAMP in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva, mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2622 Product name: Recombinant human CAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC055089 Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Predict reactive species\nFull Name: cathelicidin antimicrobial peptide\nCalculated Molecular Weight: 170 aa, 19 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC055089\nGene Symbol: CAMP\nGene ID (NCBI): 820\nRRID: AB_3670682\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49913\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888530772137,"sku":"82940-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82940-1-rr","provider":"Iright","version":"1.0","type":"link"}