{"product_id":"proteintech-82952-2-rr","title":"Proteintech, 82952-2-RR, CPO Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CPO (82952-2-RR) by Proteintech is a Recombinant antibody targeting CPO in WB, FC (Intra), ELISA applications with reactivity to human samples\n82952-2-RR targets CPO in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24059 Product name: Recombinant human CPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC112078 Sequence: YDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKII Predict reactive species\nFull Name: carboxypeptidase O\nCalculated Molecular Weight: 374 aa, 43 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC112078\nGene Symbol: CPO\nGene ID (NCBI): 130749\nRRID: AB_3670695\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8IVL8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888607711401,"sku":"82952-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82952-2-rr","provider":"Iright","version":"1.0","type":"link"}