Iright
BRAND / VENDOR: Proteintech

Proteintech, 82960-5-RR, RAB32 Recombinant monoclonal antibody

CATALOG NUMBER: 82960-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The RAB32 (82960-5-RR) by Proteintech is a Recombinant antibody targeting RAB32 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82960-5-RR targets RAB32 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells, HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Rab32 belongs to the Ras-like small GTPase superfamily, which regulate membrane dynamics, including membrane fusion/fission, exocytosis, and cytoskeletal trafficking. Rab32 anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. TRab32 also appears to be involved in autophagy and melanosome secretion. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1450 Product name: Recombinant human RAB32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC015061 Sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC Predict reactive species Full Name: RAB32, member RAS oncogene family Calculated Molecular Weight: 25 kDa GenBank Accession Number: BC015061 Gene Symbol: RAB32 Gene ID (NCBI): 10981 RRID: AB_3670706 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13637 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924