{"product_id":"proteintech-82960-5-rr","title":"Proteintech, 82960-5-RR, RAB32 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RAB32 (82960-5-RR) by Proteintech is a Recombinant antibody targeting RAB32 in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n82960-5-RR targets RAB32 in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells, HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab32 belongs to the Ras-like small GTPase superfamily, which regulate membrane dynamics, including membrane fusion\/fission, exocytosis, and cytoskeletal trafficking. Rab32 anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. TRab32 also appears to be involved in autophagy and melanosome secretion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1450 Product name: Recombinant human RAB32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC015061 Sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC Predict reactive species\nFull Name: RAB32, member RAS oncogene family\nCalculated Molecular Weight: 25 kDa\nGenBank Accession Number: BC015061\nGene Symbol: RAB32\nGene ID (NCBI): 10981\nRRID: AB_3670706\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13637\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888864874665,"sku":"82960-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-82960-5-rr","provider":"Iright","version":"1.0","type":"link"}