Proteintech, 82969-4-RR, DDX60 Recombinant monoclonal antibody

Size: 20ul / 100ul The DDX60 (82969-4-RR) by Proteintech is a Recombinant antibody targeting DDX60 in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human samples 82969-4-RR targets DDX60 in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human stomach tissue Positive FC (Intra) detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DDX60, also called FLJ20035, is an IFN-inducible gene that has been identified via a microarray analysis of genes induced by viral infection in human dendritic cells (DCs). DDX60 expression correlated strongly with immune checkpoint and immune system-related metagene clusters, and DDX60 promoted cell proliferation, migration, and invasion and was related to poor prognosis and immune resistance(PMID: 37274827). Involved in RIG-I-dependent and independent innate immune responses, DDX60 has been proven to be associated with the development of tumors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34406 Product name: Recombinant human DDX60 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1135-1250 aa of BC038115 Sequence: KLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKG Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 Calculated Molecular Weight: 1712 aa, 198 kDa Observed Molecular Weight: 170-200 kDa GenBank Accession Number: BC038115 Gene Symbol: DDX60 Gene ID (NCBI): 55601 RRID: AB_3670717 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IY21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.