{"product_id":"proteintech-83005-1-rr","title":"Proteintech, 83005-1-RR, MTAP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MTAP (83005-1-RR) by Proteintech is a Recombinant antibody targeting MTAP in WB, ELISA applications with reactivity to human, mouse samples\n83005-1-RR targets MTAP in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HCT 116 cells,  HT-29 cells,  NIH\/3T3 cells,  C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2051 Product name: Recombinant human MTAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC018625 Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS Predict reactive species\nFull Name: methylthioadenosine phosphorylase\nCalculated Molecular Weight: 283 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC018625\nGene Symbol: MTAP\nGene ID (NCBI): 4507\nRRID: AB_3670750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13126\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888651063465,"sku":"83005-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83005-1-rr","provider":"Iright","version":"1.0","type":"link"}