{"product_id":"proteintech-83010-1-rr","title":"Proteintech, 83010-1-RR, COL6A3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe COL6A3 (83010-1-RR) by Proteintech is a Recombinant antibody targeting COL6A3 in WB, ELISA applications with reactivity to human samples\n83010-1-RR targets COL6A3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOL6A3 belongs to the type VI collagen family. Collagen VI acts as a cell-binding protein. It is expected to be expressed in smooth muscle. And the calculated molecular weight of COL6A3 is 343 kDa. The protein has similar expression in obese and T2DM (2 patients, and it regulates the chemotaxis and inflammation of macrophages in adipose tissue. Its expression is also related to weight gain. The expression of this protein in adipocytes is related to insulin resistance, which is believed to depend on PPAR (peroxisome proliferator-activated receptor) α-mediated adipocyte development (PMID: 25337653). Defects in COL6A3 are a cause of Bethlem myopathy (BM). Defects in COL6A3 are a cause of Ullrich congenital muscular dystrophy (UCMD) which also known as Ullrich scleroatonic muscular dystrophy. This antibody is specific to COL6A3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34752 Product name: Recombinant human COL6A3-Specific protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1630-1850 aa of NM_004369 Sequence: PSRPEKKKADIVFLLDGSINFRRDSFQEVLRFVSEIVDTVYEDGDSIQVGLVQYNSDPTDEFFLKDFSTKRQIIDAINKVVYKGGRHANTKVGLEHLRVNHFVPEAGSRLDQRVPQIAFVITGGKSVEDAQDVSLALTQRGVKVFAVGVRNIDSEEVGKIASNSATAFRVGNVQELSELSEQVLETLHDAMHETLCPGVTDAAKACNLDVILGFDGSRDQN Predict reactive species\nFull Name: collagen, type VI, alpha 3\nCalculated Molecular Weight: 344 kDa\nObserved Molecular Weight: 300 kDa\nGenBank Accession Number: NM_004369\nGene Symbol: COL6A3\nGene ID (NCBI): 1293\nRRID: AB_3670754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P12111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888607056041,"sku":"83010-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83010-1-rr","provider":"Iright","version":"1.0","type":"link"}