{"product_id":"proteintech-83024-1-rr","title":"Proteintech, 83024-1-RR, PTPN18 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PTPN18 (83024-1-RR) by Proteintech is a Recombinant antibody targeting PTPN18 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83024-1-RR targets PTPN18 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  MCF-7 cells,  T-47D cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPN18 (also called PTP-HSCF or BDP1), a member of the protein tyrosine phosphatase superfamily, has been reported to be a tumor suppressor in breast cancer by dephosphorylating HER2 and suppressing cell proliferation and invasion. In addition to the well-established role of PTPN18 in breast cancer, our previous study found that PTPN18 and CSK cooperate to inhibit the events triggered by SRC kinases. (PMID: 35982039)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34048 Product name: Recombinant human PTPN18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-351 aa of BC052800 Sequence: VQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV Predict reactive species\nFull Name: protein tyrosine phosphatase, non-receptor type 18 (brain-derived)\nCalculated Molecular Weight: 460 aa, 50 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC052800\nGene Symbol: PTPN18\nGene ID (NCBI): 26469\nRRID: AB_3670764\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99952\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888659714217,"sku":"83024-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83024-1-rr","provider":"Iright","version":"1.0","type":"link"}