{"product_id":"proteintech-83085-3-rr","title":"Proteintech, 83085-3-RR, SLC35F4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC35F4 (83085-3-RR) by Proteintech is a Recombinant antibody targeting SLC35F4 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83085-3-RR targets SLC35F4 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34518 Product name: Recombinant human SLC35F4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-521 aa of NM_001206920 Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA Predict reactive species\nFull Name: solute carrier family 35, member F4\nCalculated Molecular Weight: 521 aa, 58 kDa\nGenBank Accession Number: NM_001206920\nGene Symbol: SLC35F4\nGene ID (NCBI): 341880\nRRID: AB_3670801\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: A4IF30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888866152617,"sku":"83085-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83085-3-rr","provider":"Iright","version":"1.0","type":"link"}