{"product_id":"proteintech-83106-1-rr","title":"Proteintech, 83106-1-RR, DDX19A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DDX19A (83106-1-RR) by Proteintech is a Recombinant antibody targeting DDX19A in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83106-1-RR targets DDX19A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells,  HepG2 cells,  mouse thymus tissue\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX19A, also known as DDX19L, belongs to the DEAD-box helicase family. DDX19A was identified as a novel cytosolic RNA sensor that could activate the NLRP3 inflammasome during virus infection. In addition, DDX19A was proven to be associated with NADPH oxidase 1 (NOX1)-mediated oxidative stress in tumor necrosis factor (TNF)-α-induced A549 cell (PMID: 33968728).  It \nmay represent biomarkers of metastasis and novel therapeutic targets in CSCC patients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7362 Product name: Recombinant human DDX19A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-478 aa of BC005162 Sequence: MMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-As) box polypeptide 19A\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC005162\nGene Symbol: DDX19A\nGene ID (NCBI): 55308\nRRID: AB_3670818\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NUU7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888418934953,"sku":"83106-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83106-1-rr","provider":"Iright","version":"1.0","type":"link"}