Iright
BRAND / VENDOR: Proteintech

Proteintech, 83108-1-RR, ODC1 Recombinant monoclonal antibody

CATALOG NUMBER: 83108-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ODC1 (83108-1-RR) by Proteintech is a Recombinant antibody targeting ODC1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83108-1-RR targets ODC1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29751 Product name: Recombinant human ODC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-188 aa of BC025296 Sequence: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELN Predict reactive species Full Name: ornithine decarboxylase 1 Calculated Molecular Weight: 461 aa, 51 kDa GenBank Accession Number: BC025296 Gene Symbol: ODC1 Gene ID (NCBI): 4953 RRID: AB_3670820 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11926 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924