{"product_id":"proteintech-83169-5-rr","title":"Proteintech, 83169-5-RR, SMAD4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SMAD4 (83169-5-RR) by Proteintech is a Recombinant antibody targeting SMAD4 in WB, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, mouse samples\n83169-5-RR targets SMAD4 in WB, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HEK-293 cells,  NIH\/3T3 cells,  MCF-7 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\nPositive ChIP-qPCR detected in: TGF-β1 (7 ng\/ml, 1 h) HaCaT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammalian homologs of the Drosophila Mad gene include Smad1, Smad2, Smad3, Smad4 (DPC4), Smad5, Smad6, Smad7 and Smad8.  Smad1 and Smad5 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF  and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin\/ TGF  signaling by interfering with TGF-mediated phosphorylation of other Smad family members.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0299 Product name: Recombinant human SMAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-227 aa of BC002379 Sequence: NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPAS Predict reactive species\nFull Name: SMAD family member 4\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC002379\nGene Symbol: SMAD4\nGene ID (NCBI): 4089\nRRID: AB_3670865\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13485\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888517304489,"sku":"83169-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83169-5-rr","provider":"Iright","version":"1.0","type":"link"}