{"product_id":"proteintech-83199-2-rr","title":"Proteintech, 83199-2-RR, MIF Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MIF (83199-2-RR) by Proteintech is a Recombinant antibody targeting MIF in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83199-2-RR targets MIF in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  THP-1 cells,  RAW 264.7 cells,  Neuro-2a cells,  mouse brain tissue,  rat brain tissue\nPositive FC (Intra) detected in: Neuro-2a cells, RAW 264.7 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMacrophage migration inhibitory factor (MIF) is a homo-trimeric protein that acts as a pleiotropic pro-inflammatory cytokine. It is involved in various functions, including leukocyte recruitment, inflammation, immune responses, cell proliferation, tumorigenesis, and counter-regulation of glucocorticoids (GC). MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0574 Product name: Recombinant mouse MIF protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 2-115 aa of NM_010798.2 Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA Predict reactive species\nFull Name: macrophage migration inhibitory factor\nCalculated Molecular Weight: 13KD\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: NM_010798.2\nGene Symbol: Mif\nGene ID (NCBI): 17319\nRRID: AB_3670887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P34884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888357494953,"sku":"83199-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83199-2-rr","provider":"Iright","version":"1.0","type":"link"}