Proteintech, 83225-2-RR, SLC12A8 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC12A8 (83225-2-RR) by Proteintech is a Recombinant antibody targeting SLC12A8 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83225-2-RR targets SLC12A8 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34354 Product name: Recombinant human SLC12A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC020506 Sequence: MCSCSLTPVPEPVLREGAEGLHCSEHLLLEKAPSYGSEGPAQRVLEGTLLEFTKDMDQLLQLTRKLESSQPRQGEGNRTPESQKRKSKKATKQTLQDSFLLDLKSPPSFPVEISDRLPAASWEGQESCWNKQTSKSEGTQPEGTYGEQLVPELCNQSESSGEDFFLKSRLQEQDVWRRSTSFYTHM Predict reactive species Full Name: solute carrier family 12 (potassium/chloride transporters), member 8 Calculated Molecular Weight: 714 aa, 80 kDa GenBank Accession Number: BC020506 Gene Symbol: SLC12A8 Gene ID (NCBI): 84561 RRID: AB_3670909 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A0AV02 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.