{"product_id":"proteintech-83240-5-rr","title":"Proteintech, 83240-5-RR, USP30 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe USP30 (83240-5-RR) by Proteintech is a Recombinant antibody targeting USP30 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83240-5-RR targets USP30 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A549 cells,  HEK-293 cells,  SH-SY5Y cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP30, a mitochondrion-localized deubiquitylase, regulates mitophagy. Mitochondrial damage stimulates parkin to assemble Lys 6, Lys 11 and Lys 63 chains on mitochondria, and that USP30 is a ubiquitin-specific deubiquitylase with a strong preference for cleaving Lys 6- and Lys 11-linked multimers. USP30 can be ubiquitinated by parkin (PARK2) at Lys-235 and Lys-289. USP30 inhibition is potentially beneficial for treating Parkinson disease by promoting mitochondrial clearance and quality control. USP30 was detected 67 kDa by ubiquitination (PMID: 34704599).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7620 Product name: Recombinant human USP30 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 159-508 aa of BC004868 Sequence: VITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE Predict reactive species\nFull Name: ubiquitin specific peptidase 30\nCalculated Molecular Weight: 58.5 kDa\nObserved Molecular Weight: 59-67 kDa\nGenBank Accession Number: BC004868\nGene Symbol: USP30\nGene ID (NCBI): 84749\nRRID: AB_3670916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q70CQ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888522612905,"sku":"83240-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83240-5-rr","provider":"Iright","version":"1.0","type":"link"}