{"product_id":"proteintech-83241-1-rr","title":"Proteintech, 83241-1-RR, Glypican 2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Glypican 2 (83241-1-RR) by Proteintech is a Recombinant antibody targeting Glypican 2 in ELISA applications with reactivity to human samples\n83241-1-RR targets Glypican 2 in ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: SH-SY5Y cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPC2 (glypican 2), which is expected to be located in cell membrane and extracellular space. It is  expressed in lymphoid tissue, skin and testis. The calculated molecular weight of the protein is 62 kDa. GPC2 is mainly active in growing nervous tissues and thyroid cancer tissues (PMID: 28616017). It participates in the growth and differentiation of neuronal axons. Increasing evidence has demonstrated the overexpression of GPC2 in neuroblastoma, a kind of childhood cancer. There is a discovery that GPC2 can be employed as a diagnostic, prognostic, and immunological predictor of generalized cancers. The study may broaden the train of thought toward application of GPC2 in immunotherapy (PMID: 35345673).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nAffinity: K D \u0026lt;1.00 x 10 -12 M K Off \u0026lt;1.00 x 10 -6 M K On =1.07 x 10 5 M\nImmunogen: CatNo: Ag4041 Product name: Recombinant human GPC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC027972 Sequence: MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQ Predict reactive species\nFull Name: glypican 2\nCalculated Molecular Weight: 579 aa, 63 kDa\nObserved Molecular Weight: 62，70-100 kDa\nGenBank Accession Number: BC027972\nGene Symbol: GPC2\nGene ID (NCBI): 221914\nRRID: AB_3670917\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888869036201,"sku":"83241-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83241-1-rr","provider":"Iright","version":"1.0","type":"link"}