{"product_id":"proteintech-83258-6-rr","title":"Proteintech, 83258-6-RR, CBX5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CBX5 (83258-6-RR) by Proteintech is a Recombinant antibody targeting CBX5 in WB, IF\/ICC, ELISA, ChIP-qPCR applications with reactivity to human samples\n83258-6-RR targets CBX5 in WB, IF\/ICC, ELISA, ChIP-qPCR applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  HEK-293 cells,  MCF-7 cells,  Jurkat cells,  A431 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive ChIP-qPCR detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with \nlamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur \nat various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34810 Product name: Recombinant human CBX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-120 aa of BC006821 Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG Predict reactive species\nFull Name: chromobox homolog 5 (HP1 alpha homolog, Drosophila)\nCalculated Molecular Weight: 191 aa, 22 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC006821\nGene Symbol: CBX5\nGene ID (NCBI): 23468\nRRID: AB_3670930\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P45973\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888399372457,"sku":"83258-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83258-6-rr","provider":"Iright","version":"1.0","type":"link"}