{"product_id":"proteintech-83263-4-rr","title":"Proteintech, 83263-4-RR, GNA12 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GNA12 (83263-4-RR) by Proteintech is a Recombinant antibody targeting GNA12 in WB, ELISA applications with reactivity to human, mouse, rat samples\n83263-4-RR targets GNA12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HepG2 cells,  HeLa cells,  mouse pancreas tissue,  rat pancreas tissue,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35068 Product name: Recombinant human GNA12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-172 aa of BC087537 Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein) alpha 12\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC087537\nGene Symbol: GNA12\nGene ID (NCBI): 2768\nRRID: AB_3670934\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q03113\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888638775465,"sku":"83263-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83263-4-rr","provider":"Iright","version":"1.0","type":"link"}