{"product_id":"proteintech-83272-1-rr","title":"Proteintech, 83272-1-RR, KERA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KERA (83272-1-RR) by Proteintech is a Recombinant antibody targeting KERA in IF-P, FC (Intra), ELISA applications with reactivity to human samples\n83272-1-RR targets KERA in IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF-P detected in: rat eye tissue\nPositive FC (Intra) detected in: U251\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratocan and Lumican are the predominant class II SLRPs(Small leucine-rich proteoglycans) in the corneal stroma. While not totally corneal-specific together these SLRPs are excellent biomarkers for the tissue. Mutant mice deficient for keratocan expression have transparent but thin corneal stromas with a mild increase in collagen fibril diameter with no further abnormalities.In humans, mutations in the keratocan gene are associated with a flattened cornea in a rare condition known as cornea plana.  The relative specificity of keratocan to corneal keratocytes has been useful for tissue-specific targeting for genetic manipulation of the corneal stroma.(PMID: 32663498)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34171 Product name: Recombinant human KERA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-320 aa of BC032667 Sequence: RLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGP Predict reactive species\nFull Name: keratocan\nCalculated Molecular Weight: 352 aa, 41 kDa\nGenBank Accession Number: BC032667\nGene Symbol: KERA\nGene ID (NCBI): 11081\nRRID: AB_3670944\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O60938\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888774107305,"sku":"83272-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83272-1-rr","provider":"Iright","version":"1.0","type":"link"}