{"product_id":"proteintech-83275-2-rr","title":"Proteintech, 83275-2-RR, EPB41L3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EPB41L3 (83275-2-RR) by Proteintech is a Recombinant antibody targeting EPB41L3 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83275-2-RR targets EPB41L3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPB41L3, also known as 4.1B and DAL1, belongs to the protein 4.1 family. It is a tumor suppressor that inhibits cell proliferation and promotes apoptosis. EPB41L3 modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 (PMID: 15334060, 15737618). DAL1 loss is an early event in meningioma tumorigenesis (PMID: 10888600).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1089 Product name: Recombinant human EPB41L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-312 aa of BC008377 Sequence: MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGS Predict reactive species\nFull Name: erythrocyte membrane protein band 4.1-like 3\nCalculated Molecular Weight: 121 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: BC008377\nGene Symbol: EPB41L3\nGene ID (NCBI): 23136\nRRID: AB_3670945\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9Y2J2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888612757673,"sku":"83275-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83275-2-rr","provider":"Iright","version":"1.0","type":"link"}