{"product_id":"proteintech-83277-1-rr","title":"Proteintech, 83277-1-RR, EPHB2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EPHB2 (83277-1-RR) by Proteintech is a Recombinant antibody targeting EPHB2 in WB, ELISA applications with reactivity to human samples\n83277-1-RR targets EPHB2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, U-251 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28786 Product name: Recombinant human EPHB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 886-986 aa of BC018763 Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG Predict reactive species\nFull Name: EPH receptor B2\nCalculated Molecular Weight: 987 aa, 108 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC018763\nGene Symbol: EPHB2\nGene ID (NCBI): 2048\nRRID: AB_3670947\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P29323\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888369782953,"sku":"83277-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83277-1-rr","provider":"Iright","version":"1.0","type":"link"}