{"product_id":"proteintech-83279-1-rr","title":"Proteintech, 83279-1-RR, TFPI2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TFPI2 (83279-1-RR) by Proteintech is a Recombinant antibody targeting TFPI2 in WB, ELISA applications with reactivity to Human samples\n83279-1-RR targets TFPI2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa\/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33467 Product name: Recombinant human TFPI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-190 aa of NM_001271003.1 Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG Predict reactive species\nFull Name: tissue factor pathway inhibitor 2\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 26-36 kDa\nGenBank Accession Number: NM_001271003.1\nGene Symbol: TFPI2\nGene ID (NCBI): 7980\nRRID: AB_3670948\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P48307\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888535752873,"sku":"83279-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83279-1-rr","provider":"Iright","version":"1.0","type":"link"}