Proteintech, 83288-1-RR, NUP85 Recombinant monoclonal antibody

Size: 20ul / 100ul The NUP85 (83288-1-RR) by Proteintech is a Recombinant antibody targeting NUP85 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83288-1-RR targets NUP85 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. NPCs are key for nucleocytoplasmic transport, but also regulate the mitotic machinery, transcription and chromatin organization through transport-independent mechanisms. The NUP107-160 complex is acknowledged to contribute to the assembly and maintenance of the NPC structure. Members of this largest subcomplex of the NPC associate with kinetochores, mitotic spindles, centrosomes and mitotic checkpoint regulators for proper completion of the cell cycle . Downregulation of NUP107-160 subcomplex members resulted in defective cytokinesis, compromised microtubule structures, altered cytoskeletal dynamics, impaired chromosome segregation and differentiation. (PMID:34170319) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7086 Product name: Recombinant human Pericentrin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 307-656 aa of BC000697 Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS Predict reactive species Full Name: nucleoporin 85kDa Calculated Molecular Weight: 75 kDa GenBank Accession Number: BC000697 Gene Symbol: NUP85 Gene ID (NCBI): 79902 RRID: AB_3670954 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BW27 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.