{"product_id":"proteintech-83288-2-rr","title":"Proteintech, 83288-2-RR, NUP85 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NUP85 (83288-2-RR) by Proteintech is a Recombinant antibody targeting NUP85 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83288-2-RR targets NUP85 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse liver tissue,  HeLa cells,  K-562 cells,  HepG2 cells,  COLO 320 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNucleoporin 85 (Nup85) (also known as FROUNT) is a protein that in humans is encoded by the NUP85 gene. This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. Nuclear pore complexes are embedded in the nuclear envelope and promote bidirectional transport of macromolecules between the cytoplasm and nucleus. The encoded protein can also bind to the C-terminus of chemokine (C-C motif) receptor 2 (CCR2) and promote chemotaxis of monocytes, thereby participating in the inflammatory response.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7086 Product name: Recombinant human Pericentrin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 307-656 aa of BC000697 Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS Predict reactive species\nFull Name: nucleoporin 85kDa\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC000697\nGene Symbol: NUP85\nGene ID (NCBI): 79902\nRRID: AB_3670955\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BW27\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888437907625,"sku":"83288-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83288-2-rr","provider":"Iright","version":"1.0","type":"link"}