{"product_id":"proteintech-83317-5-rr","title":"Proteintech, 83317-5-RR, ADRB2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ADRB2 (83317-5-RR) by Proteintech is a Recombinant antibody targeting ADRB2 in IF\/ICC, ELISA applications with reactivity to human samples\n83317-5-RR targets ADRB2 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and\/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity, and type 2 diabetes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3715 Product name: Recombinant human ADRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-413 aa of BC012481 Sequence: SRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL Predict reactive species\nFull Name: adrenergic, beta-2-, receptor, surface\nCalculated Molecular Weight: 46 kDa\nGenBank Accession Number: BC012481\nGene Symbol: ADRB2\nGene ID (NCBI): 154\nRRID: AB_3670983\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P07550\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888851865769,"sku":"83317-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83317-5-rr","provider":"Iright","version":"1.0","type":"link"}